Deen Dayal Upadhyay Gorakhpur University

About: Deen Dayal Upadhyay Gorakhpur University is a education organization based out in Gorakhpur, Uttar Pradesh, India. It is known for research contribution in the topics: Thermal decomposition & Lymnaea acuminata. The organization has 1032 authors who have published 1591 publications receiving 21734 citations. The organization is also known as: Gorakhpur University.

Insights to Sequence Information of Polyphenol Oxidase Enzyme from Different Source Organisms

Abstract: Polyphenol oxidases (PPOs) are widely distributed enzymes among animals, plants, bacteria, and fungi. PPOs often have significant role in many biologically essential functions including pigmentation, sclerotization, primary immune response, and host defense mechanisms. In the present study, forty-seven full-length amino acid sequences of PPO from bacteria, fungi, and plants were collected and subjected to multiple sequence alignment (MSA), domain identification, and phylogenetic tree construction. MSA revealed that six histidine, two phenylalanine, two arginine, and two aspartic acid residues were highly conserved in all the analyzed species, while a single cysteine residue was conserved in all the plant and fungal PPOs. Two major sequence clusters were constructed by phylogenetic analysis. One cluster was of the plant origin, whereas the other one was of the fungal and bacterial origin. Motif GGGMMGDVPTANDPIFWLHHCNVDRLWAVWQ was found in all the species of bacterial and fungus sources. In addition, seven new motifs which were unique for their group were also identified.

Piscicidal activity of leaf and bark extract of Thevetia peruviana plant and their biochemical stress response on fish metabolism.

Abstract: Objectives: The leaf and bark of Thevetia peruviana (Family: Apocynaceae) plant was administered for 24 h to the freshwater fish Catla catla (Hamilton) to evaluate their piscicidal ac- tivity in laboratory and cemented pond condition. Materials and Methods and Results: The LC50 values of leaf and bark extracts of different

Combination of molluscicides with attractant carbohydrates and amino acids in bait formulation against the snail Lymnaea acuminata.

Abstract: Aim: Fascioliasis is an impor- tant helminth disease caused by Fasciola (F.) he- patica and F. gigantica of Asia and Africa. This disease belongs to the plant-borne trematode zoonoses. Human infection has been reported in 51 different countries from 5 continents. One of the possible approaches to control this problem is to interrupt the life cycle of the parasitic trematodes by eliminating the snail. Materials and Methods: Snails attractant pellets (SAP) were prepared from binary combi- nation of carbohydrate + amino acid (20 mM) in 2% agar solution with active molluscicidal com- ponent Ferula asafoetida (ferulic acid, umbellif- erone), Syzygium aromaticum (eugenol), Carum carvi (limonene). Attraction of snails to different combinations was studied by using clear glass aquaria having diameter of 30 cm. Each aquari- um was divided into four concentric zones; zone-3 (central zone), zone-2 and zone-1 (mid- dle zone) and zone-0 (outer zone) had a diame- ter of 13, 18, 24, and 30 cm, respectively. The behavioral responses of snails to these binary combinations of carbohydrate and amino acid in bait formulation were examined. The fraction of snails that was in contact with the SAP at different times was used as a measure of at- traction. Results: Among all the binary combination of carbohydrate+amino acid+molluscicide after 2h of experiment, highest attraction of snail (54.71%) was observed towards the SAP con- taining starch+histidine+limolene. Limonene+ starch+histidine containing SAP emerged as the strongest bait formulation (96h LC50 0.74%) against Lymnaea acuminata. Conclusions: The present study suggested that the molluscicides of plant origin could be used with varying degrees of success in bait for- mulation.

Impact of males on the progeny sex ratio of Campoletis chlorideae (Hym., Ichneumonidae), a parasitoid of Helicoverpa armigera (Hübner) (Lep., Noctuidae)

Abstract: The endoparasitoid Campoletis chlorideae and its host Helicoverpa armigera were reared in the laboratory to determine the progeny sex ratio of C chlorideae in the presence and absence of male parasitoids It was observed that the presence of male parasitoids affects the progeny sex ratio by decreasing the number of females in the offspring population, ie a significant increase in the proportion of males was observed in united sexes Therefore, while constructing the life table of the parasitoid, the effect of presence of male parasitoids, should be considered together with other factors, which decreases the efficiency of the parasitoid