Showing papers in "Physica Status Solidi (a) in 1975"

Theory of the effect of dynamic strain aging on mechanical properties

Abstract: Dynamic strain aging (DSA) in solid solutions is described as diffusion of solute atoms to mobile dislocations, temporarily arrested at obstacles. As a consequence the solute concentration experienced locally by the dislocations depends on the time of arrest and the solute diffusion coefficient. Starting from this idea the dependence of the flow stress on strain rate, temperature, and strain in the presence of DSA is calculated. A criterion for the onset of serrated yielding is formulated. Finally the change in strain rate sensitivity due to DSA is calculated. The theory allows a qualitative and in some respects a quantitative comparison with experimental results of which some examples are given.

The determination of foil thickness by scanning transmission electron microscopy

Abstract: A simple and accurate method of determining foil thickness is described. The method makes use of measurements of the spacing of intensity oscillations in convergent beam diffraction patterns obtained with commercial scanning transmission electron microscopes. Extension of the technique to determination of extinction distances and anomalous absorption parameters required for the two-beam dynamical theory is outlined briefly. Une methode simple et exacte pour determiner l′epaisseur des echantillons minces est decrite. Cette methode se sert des mesures d′espacement aux oscillations d′intensite qui se trouvent sur les figures de diffraction obtenues au moyen d′un microscope electronique industriel a balayage par transmission. L′extension de cette methode pour determiner les distances d′extinction et des parametres d′absorption anomalaux necessaires pour la theorie dynamique a deux rayons est brievement discutee.

Optical and electrical properties of doped In2O3 films

Abstract: Sn doped In2O3 films are electrically conductive and transparent in the visible range of the spectrum. Films with a plasma wavelength in the 1 μm region have been prepared by spraying a solution of InCl3 and SnCl4 onto a heated substrate. The free electron concentration is observed to increase with the Sn content up to a maximum. A tentative explanation of this maximum is presented. The optical constants of the films are compared with theoretical values obtained from electrical data. At long wavelengths the experimental results are in good agreement with the classical dispersion formula of a free electron gas. At wavelengths in the region of and shorter than the plasma wavelength the damping is found to be smaller than that predicted by classical theory. Films with a rough surface, typical dimensions of the roughness being 10−5 cm, exhibit an additional surface plasmon absorption. In conjunction with the shift of the plasma edge to shorter wavelengths with increasing free electron density, a shift of the UV-absorption edge to shorter wavelengths is observed, corresponding to the rise of the Fermi level within a parabolic conduction band. Consequences for the valence band structure are discussed. Sn-dotierte In2O3-Schichten sind elektrisch leitend und im Sichtbaren transparent. Schichten mit einer Plasmawellenlange im 1 μm-Bereich wurden durch Spruhen einer Losung von InCl3 und SnCl4 auf ein erhitztes Substrat hergestellt. Mit dem Sn-Gehalt steigt die Konzentration freier Elektronen bis zu einem Maximum, fur welches eine mogliche Erklarung gegeben wird. Die optischen Konstanten der Schichten werden mit theoretischen Werten verglichen, die aus den elektrischen Daten zu erwarten sind. Bei grosen Wellenlangen lassen sich die experimentellen Ergebnisse gut mit der klassischen Dispersionsformel fur freie Elektronen wiedergeben. Im Wellenlangenbereich kleiner und gleich der Plasmawellenlange findet man abweichend von der klassischen Theorie eine geringere Dampfung. Schichten mit einer rauhen Oberflache – typisch sind Dimensionen von 10−5 cm – zeigen zusatzlich eine Oberflachenplasmonen-Absorption. Gleichzeitig mit einer Verschiebung der Plasmakante zu kleineren Wellenlangen durch eine gesteigerte Dichte freier Elektronen wird eine Verschiebung der UV-Absorptionskante zu kleineren Wellenlangen beobachtet, was einem Anheben des Fermi-Niveaus in und innerhalb eines parabolischen Leitungsbandes entspricht. Konsequenzen fur die Valenzbandstruktur werden hieraus abgeleitet.

Crystal structure and interatomic distances in GaSe

Abstract: After a comparison of the β-, ϵ-, γ-, and δ-type GaSe crystal structures, the different interlayer interactions are discussed. New values for the intralayer interatomic distances Se–Ga = 2.463 (15) A, Ga–Ga = 2.457 (18) A, and the interlayer distance Se–Se = 3.880 (15) A are proposed. These are mean values for the δ-type determined with a higher accuracy than the previous ones, relevant to the ϵ- and γ-type structure. The influence of the growth method on crystal type and dislocation density are discussed.

Work function measurements on (100) and (110) surfaces of silver

Abstract: (100) and (110) single crystals of silver were cleaned by electron and argon-ion bombardment in ultra-high vacuum. The work functions of the bulk crystals, and of silver films formed upon them by autoepitaxy, were determined photoelectrically. The bulk crystals had work functions of (4.64 ± 0.02) eV and (4.52 ± 0.02) eV respectively. The effect of the deposition of silver films was to reduce the work function, but continued cycles of deposition and annealing at 500 to 600 K caused the work function to return to a value very close to that of the bulk crystal. An annealed film of silver deposited in stages on a mica substrate at 425 K had a work function of (4.72 ± 0.02) eV, corresponding to that of the (111) silver surface. If the mica remained at room temperature during deposition, the work function was about 4.5 eV. The work function of a thick polycrystalline film of silver on quartz was (4.26 ± 0.02) eV. The results support the Smoluchowski correlation of work function with surface atom density.

Calculation of potential energy parameters form crystalline state properties

Abstract: A simple method is developed to calculate Mie (Lennard-Jones) potential parameters for metals, using crystalline state physical properties at any given temperature Calculated values are in good agreement with some values reported in the literature

The Interpretation of Non‐Ideal Dielectric Admittance and Impedance Diagrams

Abstract: It is well known that many dielectric materials such as ionically conducting ceramics show complex susceptibility (Cole-Cole) plots which are non-ideal, i.e. which depart seriously from the ideal semi-circular form. It is also known that similar departures may be found in the corresponding impedance or Z-plots and admittance or Y-plots. The commonly accepted interpretation of skewed circular arcs and spurs in the Y and Z representations relies on the concept of Warburg impedance which is based on the assumption of a diffusive model for the system. However, the Warburg impedance can only explain circular arcs and spurs inclined at an angle π/4 to the normal, while the available experimental data show clearly a wide range of angles in which the unit slope angle represents only a particular case. The present paper suggests that a more plausible interpretation may be possible which includes the whole observed range of behaviour and which makes use of the concept of „non-Debye capacitance” having a frequency-independent ratio of the imaginary to the real parts of the complex dielectric susceptibility. Such non-Debye properties are generally found in most solid dielectric materials and a simple physical model has been proposed to explain this almost universal behaviour. A discussion is given of the application of this concept to the interpretation of a wide range of complex Z- and Y-plots giving a simple and physically plausible explanation of the observed behaviour. Es ist gut bekannt, das viele dielektrische Materialien wie ionisch leitende Keramiken komplexe Suszeptibilitats (Cole-Cole)kurven zeigen, die nicht-ideal sind, d. h. die erheblich von der idealen Halbkreisform abweichen. Es ist auch bekannt, das ahnliche Abweichungen in den entsprechenden Impedanz- oder Z-Kurven und Admittanz- oder Y-Kurven gefunden werden konnen. Die ublich akzeptierte Deutung der sciefen Kreisbogen und Spuren in den Y- und Z-Darstellungen beruht auf dem Konzept der Warburg-Impedanz, das auf der Annahme eines Diffusionsmodells fur das System beruht. Jedoch kann die Warburg-Impedanz nur Kreisbogen und Spuren erklaren, die mit einem Winkel von π/4 gegen die Normale geneigt sind, wahrend die vorliegenden experimentellen Daten klar einen breiten Bereich von Winkeln zeigen, in dem der Einheits-Neigungswinkel nur einen speziellen Fall darstellt. In der Arbeit wird vorgeschlagen, das eine plausible Reinterpretation moglich ist, die den gesamten beobachteten Verhaltensbereich einschliest und Gebrauch macht von der „Nicht-Debye-Kapazitat”, die ein frequenzunabhangiges Verhaltnis des Imaginarteils zum Realteil der komplexen dielektrischen Suszeptibilitat besitzt. Derartige Nicht-Debye-Eigenschaften werden allgemein in den meisten festen dielektrischen Materialien gefunden, und ein einfaches physikalisches Modell zur Erklarung dieses fast universellen Verhaltens wird vorgeschlagen. Die Anwendung dieses Konzepts fur die Interpretation eines weiten Bereichs komplexer Z- und Y-Kurven wird diskutiert und ergibt eine einfache und physikalisch plausible Erklarung des beobachteten Verhaltens.

Luminescence of Lead Molybdate and Lead Tungstate. I. Experimental

Abstract: Optical properties of single crystals of lead molybdate and lead tungstate (scheelite structure) have been investigated in order to identify the nature of the luminescent centres. Absorption, emission, and excitation spectra at different temperatures (1.5 to 300 K) and photoconductivity and quantum efficiency measurements at 77 K are reported. The greenyellow emission of both compounds is probably due to a centre being very much alike in PbMoO4 and PbWO4. The blue emission of PbWO4 is ascribed to the tungstate group as in the alkaline-earth tungstates. Die optischen Eigenschaften von Bleimolybdat- und Bleiwolframateinkristallen (Scheelitstruktur) wurden zur Ermittlung der Art der emittierenden Zentren untersucht. Absorptions-, Emissions- und Anregungsspektren wurden bei verschiedenen Temperaturen (1,5 bis 300 K) und die Photoleitfahigkeit und Quantenausbeute bei 77 K gemessen. Die gelbgrune Emission von PbMoO4 und PbWO4 mus wahrscheinlich Zentren zugeschrieben werden, die in beiden Verbindungen einander sehr ahnlich sind. Die blaue Emission wird auf die Wolframatgruppe wie in den Erdalkaliwolframaten zuruckgefuhrt.

The assembly of hard spheres as a structure model of amorphous iron

Abstract: Six assemblies of equal sized hard spheres have been constructed in a manner which is a modification of Bennett's global method, and packing fractions, W(r) and Im(s) of the assemblies have been calculated. Some of the W(r) and Im(s) have subpeaks or shoulders on the outer side of the second peaks, which are characteristic of many amorphous transition metals and their alloys. A geometrical origin of the occurrence of the subpeak or shoulder in W(r) is briefly discussed. Sechs Anordnungen von harten Kugeln gleicher Grose werden mit der modifizierten Bennett-Methode konstruiert und die Packungsanteile W(r) und Im(s) der Anordnungen berechnet. Einige der W(r) und Im(s) haben Submaxima oder Schultern auf der Flanke des zweiten Maximums, die fur viele amorphe Ubergangsmetalle und ihre Legierungen charakterisch sind. Ein geometrischer Ursprung fur das Auftreten dieses Submaximums oder der Schulter in W(r) wird diskutiert.

Luminescence of lead molybdate and lead tungstate. II. discussion

Abstract: A model is developed for the green-yellow emitting centre in PbMoO4 and PbWO4 in terms of an excited state which can be visualized as Pb3+-XO3−4, i.e. an electron localized at XO and an electron-hole at one of the surrounding Pb2+ ions. The different levels of the triplet excited state arise from splitting due to the small tetragonal distortion and spin-orbit interaction. Moreover, hyperfine interaction induces an additional splitting if the lead ion of the centre has a nuclear spin (207Pb, I = ½). In this way the four-level scheme, obtained empirically can be qualitatively understood. Hence, the two components of the emission are connected with the presence of two different kinds of lead isotopes: 207Pb with I = ½ and 204Pb, 206Pb, and 208Pb, with I = 0. The blue emission of PbWO4 can be ascribed to a charge transfer transition within the tungstate anion, as in the alkaline-earth scheelites.

Strain rate sensitivity and the portevin-le chatelier effect in Au–Cu alloys

Abstract: The effect of strain rate changes on the flow stress of Au–Cu alloys in the region of strain prior to the start of serrated yielding has been investigated. The measurements of Δσ/Δ Δσ/Δ were found to depend on strain, strain rate, temperature, and composition. Negative values of Δσ/Δ ln ϵ were observed prior to the onset of serrated yielding. The effect of base strain rate on the strain rate sensitivity of the flow stress was correlated with the effect of ϵ on the strain at the onset of serrated yielding. The results are interpreted in terms of a recent model for dynamic strain ageing based on the diffusion of solute atoms to temporarily arrested dislocations. The occurrence of pronounced flow stress transients accompanying strain rate changes was also investigated. Der Einflus der Anderung der Deformationsgeschwindigkeit auf die Fliesspanung von Au–Cu-Legierungen im Deformationsbereich vor dem Einsatz des stufenweisen Fliesens wird untersucht. Es wird gefunden, das Δσ/Δ Δσ/Δ von der Deformation, Deformationsgeschwindigkeit, Temperatur und Zusammensetzung abhangt. Vor dem Einsatz des stufenweisen Fliesens werden negative Werte von Δσ/Δ ln ϵ beobachtet. Der Einflus der Deformationsgeschwindigkeit auf die Deformationsgeschwindigkeitsempfindlichkeit der Fliesspannung wird mit dem Einflus von ϵ auf die Deformation beim Einsetzen des stufenweisen Fliesens korreliert. Die Ergebnisse werden mit einem kurzlich veroffentlichten Modell fur dynamische Deformationsalterung, das auf der Diffusion von gelosten Atomen zu zeitweise festgesetzten Versetzungen beruht, interpretiert. Auch das Auftreten von ausgepragtem Einschwingverhalten der Fliesspannung, das mit den Anderungen der Deformationsgeschwindigkeit verbunden ist, wird untersucht.

X‐Ray study of the structural first‐order phase transition (Cmca‐P42/ncm) in (CH3NH3)2CdCl4

Abstract: (CH3NH3)2CdCl4 is found to be isotructural at room temperature with (CH3NH3)2MnCl4 having the orthorhombic space group Cmca. A high temperature phase transition to a tetragonal phase could not be observed because of a decomposition slightly above 383 K. Two low temperature phase transitions are detected by means of DTA at about 283 and 173 K. The first one leads to the space group P42/ncm. A microscopic model for this phase transition is proposed. Fur die Raumtemperaturphase von (CH3NH3)2CdCl4 wird die mit (CH3NH3)2MnCl4 isostrukturelle, orthorhombische Raumgruppe Cmca gefunden. Eine Hochtemperaturumwandlung in eine tetragonale Phase konnte wegen thermischer Zersetzung oberhalb von 383 K nicht beobachtet werden. Mittels DTA werden zwei Tieftemperatur-Phasenumwandlungen bei ungefahr 283 und 173 K gefunden. Die erstere fuhrt zu einer tetragonalen Modifikation mit der Raumgruppe P42/ncm. Ein mikroskopisches Modell dieser Phasenumwandlung wird vorgeschlagen.

A simple method for the analysis of dislocation loops by means of the inside‐outside contrast on transmission electron micrographs

Abstract: A new method is proposed for the analysis (vacancy or interstital) of dislocation loops by means of the so-called inside-outside contrast. A simple and straightforward recipe is developed which is applicable in the same manner to loops of edge and of non-edge type irrespective of the loop orientation within the transmission foil; in particular, there is no reason for a subdivision of the loop orientations into “safe” and “unsafe” orientations as required when applying the method of Maher and Eyre. Es wird eine neue Method vorgeschlagen, um anhand des sogenannten “inside-outside” Kontrastes von Versetzungsringen deren Natur (Leerstellen-bzw. Zwischengitteratom-Typ) zu bestimmen. Es ergibt sich eine einfache und einheitliche Verfahrensvorschrift, die in gleicher Weise auf Versetzungsringe mit und ohne Scherkomponente angewandt werden kann, unabhangig von der Ringorientierung in der Durchstrahlungsprobe. Insbesondere bedingt diese Vorschrift keine Aufteilung der Ringorientierungen in „sichere” und „unsichere” Orientierungen, wie dies bei Anwendung der Methode von Maher und Eyre erforderlich ist.

The deformation behaviour of single crystal Ni3(Al, Ti)

Abstract: Compression tests have been carried out on Ni-rich single crystals of Ni3(Al, Ti) with [001] and [132] compression axes over the temperature range −110 to 1000 °C. The [132] orientated crystals exhibited a peak in the flow stress at about 450 °C. Slip line and dimensional analysis revealed five different modes of deformation over the temperature range studied. The significant feature of the three deformation modes that occurred below the peak flow stress temperature (450 °C) was the absence of primary cube slip. Suppressing cube slip by compressing along [001] was found to markedly increase the flow stress at high temperatures and to raise the temperature of the peak. It is proposed that the positive temperature dependence of the flow stress results from an anomalous increase in the critical resolved shear stress for octahedral slip with increasing temperature, and not from an interaction between octahedral and cube slip. Es werden Kompressionsuntersuchungen an Ni-reichen Ni3(Al, Ti)-Einkristallen mit [001]- und [132]-Kompressionsachsen im Temperaturbereich von −110 bis 1000 °C durchgefuhrt. Die in [132]-Richtung orientierten Kristalle zeigen in der Flusspannung bei etwa 450 °C ein Maximum. Die Analyse der Gleitlinien und Abmessungen ergibt funf unterschiedliche Deformationsmoden im untersuchten Temperaturbereich. Das wesentliche Merkmal der drei Deformationsmoden, die unterhalb der maximalen Temperatur der Flusspannung (450 °C) auftreten, ist das Fehlen von primarer kubischer Gleitung. Es wird gefunden, das die Unterdruckung von kubischer Gleitung durch Kompression in [001]-Richtung die Flusspannung bei hohen Temperaturen merklich erhoht und das die Temperatur des Maximums anwachst. Es wird angenommen, das die positive Temperaturabhangigkeit der Flusspannung von einem anomalen Anstieg der kritischen Schubspannung fur oktaedrische Gleitung mit steigender Temperatur herruhrt und nicht von einer Wechselwirkung zwischen oktaedrischer und kubischer Gleitung.

Phase transitions in In2Se3 as studied by electron microscopy and electron diffraction

Abstract: Indium selenide undergoes several reversible inter- and intrapolytypic phase transitions, above and below room temperature. A number of superstructures of the hexagonal (or rhombohedral) room temperature phase have been discovered by means of electron diffraction. The transition at 200 °C which corresponds to the α β transformation is accompanied by intense non-radial diffuse scattering, which is attributed to anisotropic transverse acoustic phonons. On cooling, a one-dimensional deformation modulated structure is formed, which is interpreted as the frozen-in configuration of the predominant vibration mode, which becomes soft below the transition temperature in the range 60 to 200 °C. This transition shows a large hysteresis, which is also found in thermal expansion. A new low temperature phase, which is presumably orthorhombic, is discovered on cooling below −125 °C. The structure of this phase can alternatively be described as being the result of pairing of indium ions or as the frozen-in configuration of a longitudinal mode. Both phases exhibit a domain structure, which in the case of the α-phase can be revealed by lattice resolution. Several high temperature superstructures are observed by means of electron diffraction. A direct relationship with the β-phase is established and in a number of cases the superperiods are directly imaged. Indiumselenid hat oberhalb und unterhalb Zimmertemperatur einige reversible Inter und Intrapolytyp-Phasenubergange. Eine Anzahl von Superstrukturen der hexagonalen Phase bei Zimmertemperatur wurde mit Elektronenbeugung gefunden. Der Ubergang bei 200 °C, der dem α β-Ubergang entspricht, wird von einer intensiven, diffusen, nicht-radialen Streuung begleitet, die anisotropen, transversalen akustischen Phononen zugeordnet ist. Nach Abkuhlen wird eine eindimensionale deformationsmodulierte Struktur gebildet, die als eingefrorene Konfiguration der vorherrschenden Schwingungsmode gedeutet wird und die unterhalb der Ubergangstemperatur im Bereich von 60 bis 200 °C „soft” wird. Dieser Ubergang zeigt eine grose Hysterese, die auch in der thermischen Ausdehnung beobachtet wird. Eine neue Tieftemperaturphase, die wahrscheinlich orthorhombisch ist, wurde nach Abkuhlen unterhalb −125 °C beobachtet. Die Struktur dieser Phase kann entweder als Ergebnis der Paarbildung von Indiumionen oder als eingefrorene Konfiguration einer longitudinalen Mode beschrieben werden. Beide Phasen zeigen eine Domanenstruktur, die im Falle der α-Phase durch Gitterzerlegung beobachtet werden kann. Einige Hochtemperatur-Superstrukturen werden mit Elektronenbeugung beobachtet. Eine direkte Beziehung zur β-Phase wird festgestellt und in einigen Fallen werden die Superperioden direkt abgebildet.

Defect Structures and Long‐Range‐Order Parameters in Off‐Stoichiometric Ni3Al

Abstract: The deviation of the composition from stoichiometry in the Ll2-type intermetallic compound Ni3Al has been systematically investigated in relation to the change in lattice parameter, density, and long-range-order parameter, S. Special attention is paid for such crystallographic features as the kind of defect structure and the atom sites in off-stoichiometric composition. It is concluded that substitution occurs and maximum order retains at both side of stoichiometry. Therefore it is obvious that at the Ni-rich side all Al atoms occupy cube corner sites and the Ni atoms occupy all face centre sites and vacant cube corner sites of the unit cell, while at the Al-rich side all Ni atoms occupy face centre sites and the Al atoms occupy all cube corner sites and vacant face centre sites of the unit cell. Die Abweichung der Zusammensetzung von der Stochiometrie wurde in der intermetallischen Verbindung Ni3Al vom Ll2-Typ systematisch bezuglich der Anderung des Gitterparameters, der Dichte und des Fernordnungsparameters S untersucht. Insbesondere wurden solche kristallographischen Charakteristika, wie die Art der Defektstruktur und der Atomplatze bei nichtstochiometrischer Zusammensetzung beobachtet. Es wird gefunden, das Substitution auftritt und maximale Ordnung an beiden Seiten der Stochiometrie erhalten wird. Daraus folgt, das an der Ni-reichen Seite alle Al-Atome die Platze der Wurfelecken besetzen und die Ni-Atome alle flachenzentrierten Platze und freien Platze der Wurfelecken der Einheitszelle, wahrend an der Al-reichen Seite alle Ni-Atome flachenzentrierte Platze besetzen und die Al-Atome alle Platze der Wurfelecken und freien flachenzentrierten Platze der Einheitszelle.

Thermoluminescence and lattice defects in LiF

Abstract: The principal effect of thermal and optical treatments in an ionic solid is to alter the lattice defect equilibrium, including the concentration and arrangement of ion vacancies, impurities, impurity-vacancy associates, and assorted electrons and holes which may be associated with such defects. This paper examines the relationship between these defects and thermoluminescence in the case of lithium fluoride at and above room temperature. The discussion focuses on lattice defect equilibrium, thermoluminescent trapping centers, the relationship between recombination and luminescence, the supralinearity and sensitization of the dosimetry grade of LiF and activation energy parameters.

On the second‐order phase transition in (CH3NH3)2MnCl4. A single‐crystal neutron diffraction study at 404 and 293 K

Abstract: The crystal structure of (CH3NH3)2MnCl4 is determined by neutron diffraction at 404 and 293 K in order to obtain a microscopic description of the second-order structural phase transition at 393.8 K. The high temperature phase has a disordered K2NiF4-type structure (I4/mmm). The ordered structure at room temperature (Abma) can be seen as a “frozen” moment picture of the high temperature modification accompanied by a displacement of the CH3-groups. The continuous phase transition is mainly of the order-disorder type. A soft mode may be associated with the displacive behaviour. Mit Hilfe der Neutronenbeugung wurden die Kristallstrukturen von (CH3NH3)2MnCl4 bei 404 und 293 K bestimmt, um eine mikroskopische Beschreibung des strukturellen Phasenubergangs zweiter Ordnung bei 393,8 K zu erhalten. Die Hochtemperaturphase hat eine ungeordnete Struktur vom K2NiF4-Typ (I4/mmm). Die geordnete Struktur bei Zimmertemperatur kann als „eingefrorene” Momentaufnahme der Hochtemperaturmodifikation mit einer zusatzlichen Verschiebung der CH3-Gruppen angesehen werden. Der kontinuierliche Phasenubergang ist im wesentlichen ein Ordnungs-Unordnungsubergang. Mit der Verschiebung kann eine soft mode verbunden sein.

Investigation of the deformation mechanism of MgO crystals affected by concentrated load

Abstract: The mechanism of deformation under the indentation of MgO crystals has been studied by transmission and scanning electron microscopy. The dislocation structure and Burgers vectors of rosette dislocations are determined. The nature and geometry of cathodoluminescence around indentation have been also investigated. The luminescence radiation is shown to be caused by interstitial point defects built up under indentation. [Russian text ignoreed].

Energy Levels of Electron and Hole Traps in the Band Gap of Doped Anthracene Crystals

Abstract: It is discussed under which conditions electron and hole trap levels in the band gap of doped molecular crystals may be described by a simple polarization model taking into account the shift of electron and hole levels (positive and negative ionic states) of the free dopant molecule during its incorporation into a polarizable crystal-continuum. Measurements are presented for anthracene doped with tetracene (T), acridine (Ac), and phenazine (Ph). The trap levels obtained are: E = 0.42 eV; E = 0.12 to 0.17 eV (depending on the orientation); E = 0 eV; E = 0.21 eV, E = 0 eV; E = 0.54 eV for holes (p) and electrons (n), respectively.

Misorientation and tetragonal distortion in heteroepitaxial vapor-Grown III–V structures†

Abstract: Heteroepitaxial deposits of III–V vapor phase epitaxy (VPE) alloys on (001) substrates have been found to exhibit distortions such that: 1. the epitaxial layers are not parallel to the substrate but are inclined to it by as much as 2°, and 2. the epitaxial lattice is tetragonally distorted normal to the substrate with c/a ratios as high as 1.003. These effects habe been observed in non-graded (abrupt) and in compositionally graded (both step and continuous) layers of InxGa1−xP, GaAsxP1−x, and InxGa1−xAs on GaAs and GaP substrates and vary with the amount of lattice mismatch. Misorientation is shown to be a general phenomena in VPE growth associated with relieved lattice mismatch (regardless of the grading technique employed), whereas tetragonal distortion is felt to be a manifestation of the Poisson effect normal to the substrate associated with unrelived lattice mismatch and is shown to be dependent on grading technique. Possible device effects are also discussed. Es wurde gefunden, das durch Dampfphasenepitaxie abgeschiedene heteroepitaxiale III–V-Legierungen auf (001)-Substraten Verzerrungen in folgender Weise zeigen: 1. Die epitaxialen Schichten liegen nicht parallel zum Substrat, sondern sind zu ihm um etwa 2° geneigt, 2. Das Gitter der Epitaxieschicht ist normal zum Substrat tetragonal verzerrt mit c/a-Verhaltnissen bei 1,003. Diese Effekte wurden sowohl in nicht-graduierten (abrupten) als auch in verbindungsmasig graduierten (stufenweise oder kontinuierlich) Schichten von InxGa1−xP, GaAsxP1−x und InxGa1−xAs auf GaAs- und GaP-Substraten beobachtet und verandern sich mit dem Betrag der Gitter-Fehlanpassung. Es wird gezeigt, das Fehlorientierung allgemein bei Dampfphasenepitaxie auftritt und mit „abgebauter” (z. B. durch Versetzungen) Gitter-Fehlanpassung verbunden ist (unabhangig von der benutzten Gradationstechnik), wahrend tetragonale Verzerrung ein Ausdruck des Poisson-Effektes normal zum Substrat zu sein scheint, mit „nicht-abgebauter” Gitter-Fehlanpassung verbunden und abhangig von der Gradationstechnik ist. Mogliche Effekte in Halbleiterbauelementen werden auch diskutiert.

Formation of vacancy-type dislocation loops in tungsten bombarded by 60 keV Au ions

Abstract: The formation of vacancy-type dislocation loops in tungsten specimens as produced by irradiation with 60 keV Au ions is investigated by transmission electron microscopy. The majority of the loops is found to have Burgers vectors b=1/2〈111〉 and loop planes normal to n ≈ {110} (∢(b, n) ≈ 35°). The 12 different loop orientations of this type are observed with significantly different frequencies depending sensitively on the crystallographic orientation of the specimen surface. The observations are explained in terms of the elastic interaction of the growing loops with the adjacent specimen surface. The proposed interpretation of the results leads to a critical resolved shear stress τ0 of the order of magnitude of 10 N/mm2 for the onset of microslip in tungsten single crystals at room temperature, in agreement with data reported in the literature. The specific stacking fault energy on {110}-planes is estimated as γ110≈0.8 × 10−6 J/mm2.

Frequency-dependent conductivity and dielectric function of superionic conductors

Abstract: The diffusive part and the oscillatory part (optically active lattice vibrations) of the conductivity in an ionic solid are related by an oscillator strength sum rule. In a superionic conductor a non negligible fraction of the total oscillator strength is in the diffusive part. A simple model is introduced which includes both diffusive and oscillatory part, takes account of the sum rule and is able to describe the full range from an insulating ionic solid to a free ion system. The model is applied to the frequency dependent conductivity σ(ω) of AgI and β-alumina at various temperatures. σ(ω) is determined from far infrared (FIR) reflectivity experiments. The importance is shown of such measurements for screening of new potential superionic conductors. FIR experiments are not hampered by contact, polarization, and grain boundary problems. A high conductivity at frequencies below the reststrahlen bands is thus a necessary condition for a high dc conductivity. Der diffusive und der oszillatorische Anteil (infrarotaktive Gitterschwingungen) der Leitfahigkeit eines Ionenleiters sind durch eine Oszillator-Summenregel miteinander verknupft. In einem Supra-Ionenleiter ist ein nicht vernachlassigbarer Bruchteil der totalen Oszillatorstarke im diffusiven Anteil enthalten. Ein einfaches Modell wird eingefuhrt, welches sowohl das diffusive als auch das oszillatorische Verhalten enthalt, die Summenregel erfullt, und den ganzen Bereich vom isolierenden Ionenkristall bis zum freien Ionensystem beschreibt. Das Model wird auf die frequenzabhangige Ionenleitfahigkeit σ(ω) wurde durch Reflexionsmessungen im fernen Infrarot (FIR) bestimmt. Auf die Wichtigkeit solcher Messungen fur das Aufsuchen von neuen potentiellen Supraionenleitern wird hingewiesen. Bei FIR-Experimenten an Einkristallen treten keine Kontakt-, Polarisations- und Korngrenzen-Probleme auf. Eine hohe Leitfahigkeit bei Frequenzen unterhalb der Reststrahlen-Banden ist eine notwendige Bedingung fur eine hohe Gleichstrom-Leitfahigkeit.

Effects of hydrogen and oxygen on the elastic moduli of vanadium, niobium, and tantalum single crystals

Abstract: Measurements of the ultrasonic wave velocities at 30 to 50 MHz frequencies reveal very significant effects of dissolved hydrogen on the elastic shear moduli, C′ = (C11 – C12)/2 and C44, of the group V b.c.c. transition metals. In all cases C′ decreases with increasing hydrogen solute, whereas C44 increases and the bulk modulus remains nearly constant. The ΔC′ effect is interpreted as a Snoek relaxation that arises from a tetragonal elastic dipole produced by interstitial hydrogen in tetrahedral sites. The data indicate that the tetragonal distortion parameter, λ1 – λ2, is 0.11 for V, 0.051 for Nb, and 0.047 for Ta. The rate of increase in C44 is 0.5% per at% hydrogen for V, 1.8% for Nb, and 0.13% for Ta. This increase is reflected in a positive change in the isotropic Young's modulus for Nb, opposing the Snoek relaxation effect. The addition of oxygen to V and Nb produces no Snoek relaxation at these high frequencies, but the positive change in C44 is as pronounced as in the hydrogen addition. Present information is not sufficient to relate this ΔC44 effect strictly to the interstitial solute configuration. Further research is needed on the temperature dependence of the effect. Messungen der Ultraschallgeschwindigkeiten bei Frequenzen von 30 bis 50 MHz zeigen betrachtliche Einflusse von gelostem Wasserstoff auf die Schermoduli C′ = (C11 – C12)/2 und C44 der k.r.z.-Ubergangsmetalle der Gruppe V. In allen Fallen nimmt C′ mit steigendem Wasserstoffgehalt ab, wahrend C44 zunimmt und der Volumenmodul nahezu konstant bleibt. Der ΔC′-Effekt wird als Snoek-Relaxation interpretiert, die von einem tetragonalen elastischen Dipol herruhrt, der von Wasserstoff auf Tetraeder-Zwischengitterplatz erzeugt wird. Die Werte zeigen, das der Parameter der tetragonalen Verzerrung, λ1 – λ2, 0,11 fur V, 0,051 fur Nb und 0,047 fur Ta betragt. Die Anstiegsrate fur C44 betragt 0,5% pro At% Wasserstoff fur V, 1,8% fur Nb und 0,13% fur Ta. Dieser Anstieg wird als positive Anderung des isotropen Young-Moduls fur Nb beobachtet, der entgegengesetzt ist zur Snoek-Relaxation. Die Zugabe von Sauerstoff zu V und Nb erzeugt keine Snoek-Relaxation bei diesen hohen Frequenzen, jedoch ist die positive Anderung in C44 genauso ausgepragt wie bei Wasserstoffzugabe. Gegenwartige Informationen reichen nicht aus, um diesen ΔC44-Effekt direkt mit der Zwischengitterkonfiguration zu verknupfen. Weitere Untersuchungen der Temperaturabhangigkeit des Effektes sind dazu notwendig.

Phase transformations at bombardment of thin films with ions

Abstract: Phase transformation occurs in thin films of metals after bombardment with He+, N+, and Ar+ ions at an energy of 30 keV in the dose range of 1015 up to 1018 ions/cm2. The transformation of b.c.c. to f.c.c. to h.c.p. takes place in Fe and Mo films; f.c.c. to h.c.p. in Ni films; h.c.p. to f.c.c. in Ti films. The results are explained considering the storage of radiation defects when bombarding with ions of medium energy. Es wird gezeigt, das in dunnen Metallschichten nach Bombardierung mit He+-, N+- und Ar+-Ionen einer Energie von 30 keV bei Bestrahlungsdosen von 1015 bis 1018 Ionen/cm2 eine Phasentransformation erfolgt. Es finden folgende Transformationen statt: k.r.z. nach k.f.z. nach hexagonal-dichtest-gepackt in Fe- und Mo-Schichten; k.f.z. nach hexagonal-dichtest-gepackt in Ni-Schichten, hexagonal-dichtest-gepackt nach k.f.z. in Ti-Schichten. Die Ergebnisse werden unter Berucksichtigung der Tatsache diskutiert, das bei Bombardierung mit Ionen mittlerer Energie Strahlungsdefekte gespeichert werden.

X-ray study of AlxGa1-xAs epitaxial layers

Abstract: Lattice deformation and strain are studied in double-hetero-structure epitaxial layers of AlxGa1−xAs. The lattices of all three epitaxial layers are found to be tetragonally deformed under the stress due to lattice mismatch amounting to 108 dyn/cm2 at room temperature. The strains in the epitaxial layers are measured up to 800°C. The influence of the crystalline quality of the substrates on that of epitaxial layers is studied. It is observed that the density of dark spot defects in the epitaxial layers is always greater than the dislocation density in the substrates. Es werden Gittterverzerrungen und Spannungen in epitaktischen Doppelheterostrukturschichten von AlxGa1−xAs untersucht. Es wird gefunden, das die Gitter aller drei epitaktischen Schichten unter Spannung tetragonal verformt sind infolge der Gitterfehlanpassung von etwa 108 dyn/cm2 bei Zimmertemperatur. Die Spannungen in den Epitaxieschichten werden bis zu 800°C gemessen. Der Einflus der Kristallqualitat der Substrate auf die Qualitat der Epitaxieschichten wird untersucht. Es wird beobachtet, das die Dichte der Dunkelpunktdefekte in den Epitaxieschichten stets groser als die Versetzungsdichte in den Substraten ist.

Thermal expansion of some group IV elements and ZnS

Abstract: A least-squares trial and error deconvolution of the thermal expansion–temperature dependencies of silicon and germanium permits ascertainment of transverse and longitudinal contributions to thermal expansion as a function of temperature. The model consisting of a simple frequency spectrum with three or four Einstein terms provides a convenient mathematical method where a minimum of empirical parameters can reasonably represent the thermal expansion. Besides some theoretically interesting information about thermal expansion, a more precise comparison of thermal expansion data from dilatometric and X-ray methods is provided and previously unpublished data for ZnS are given. Eine Angleichungs-Dekonvolution der Kurven der thermischen Ausdehnung uber der Temperatur von Silizium und Germanium durch Versuch und Irrtum erlaubt die Ermittlung des Beitrages der Transversal- und Longitudinalwellen zur thermischen Ausdehnung als Funktion der Temperatur. Das Modell, das aus einem einfachen Frequenzspektrum mit drei oder vier Einsteintermen besteht, stellt eine brauchbare mathematische Methode zur Verfugung, in der ein Minimum empirischer Parameter die thermische Ausdehnung angemessen darstellen kann. Auser einigen theoretisch interessanten Informationen uber die thermische Ausdehnung wird ein genauerer Vergleich zwischen Werten thermischer Ausdehnung von dilatometrischen und Rontgenmethoden erhalten, und fruher unveroffentlichte Werte fur ZnS werden mitgeteilt.

The niobium–hydrogen system – an electron microscope study. II. Low‐temperature structures

Abstract: The structure and morphology of low temperature hydride phases is investigated. Quenching of dilute alloys produces small hydride particles which emitted interstitial dislocation loops into the matrix. Irreversible dislocation “skeletons” were generated when such hydride precipitates were thermally dissolved. Three ordered solutions where observed: the β-phase above −45 °C the ζ-phase from −45 to −65 °C, and the ϵ-phase below −65 °C. The reciprocal lattices of ζ and ϵ were determined. The ϵ-phase is identical with the hydride Nb4D3 found by Somenkov et al. ζ and ϵ are orthorhombic with the same lattice parameters as β. Es wurden die Struktur und Morphologie von Tieftemperatur Hydridphasen untersucht. Durch Abschrecken verdunnter Legierungen wurden kleine Hydridteilchen erzeugt, die Zwischengitteratom-Versetzungsringe in die Matrix emittierten. Durch die thermische Auflosung solcher Hydrid-Ausscheidungen wurden irreversible Versetzungs- „Skelette” gebildet. Es wurden drei geordnete Losungen beobachtet: die β-Phase oberhalb −45 °C, die ζ-Phase von −45 bis −65 °C und die ϵ-Phase unterhalb −65 °C. Es wurden dei reziproken Gitter von ζ und ϵ bestimmt. Die ϵ-Phase ist identisch mit dem Hydrid Nb4D3 das Somenkov et al. gefunden hatten. ζ und ϵ sind orthorhombisch und haben den selbe Gitterparameter wie die β-Phase.