Reduced neutralization of SARS-CoV-2 variants by convalescent plasma and hyperimmune intravenous immunoglobulins for treatment of COVID-19
Summary (2 min read)
Introduction
- 2 Hyperimmune immunoglobulin (hCoV-2IG) preparations generated from SARS-CoV-2 22 convalescent plasma (CP) are under evaluation in several clinical trials of hospitalized COVID-19 23 patients.
- Significant reduction of 36 hCoV-2IG binding was observed to the RBD-E484K followed by RBD-N501Y and minimal loss 37 of binding to RBD-K417N compared with unmutated RBD.
- For comparison with 74 hCoV-2IG, the authors evaluated nine convalescent plasma from recovered COVID-19 patients and 16 75 IVIG preparations that were manufactured with pre-pandemic plasma units prior to August 2019.
- In light of the rapid spread of SARS-CoV-2 variants of concern around the globe, it is 171 important to evaluate the therapeutic potential of both CP and hCoV-2IG against both early 172 circulating SARS-CoV-2 strains and the emerging VOCs (20-22) that can define the therapeutic 173 potential of these antibody preparations.
- In summary, both CP and hCoV-2IG demonstrated reduced neutralization titers ranging 211 from ~2-4 fold against UK & JP VOCs and ~10-20 fold against SA VOC.
SARS-CoV-2 Gene Fragment Phage Display Library (GFPDL) construction 285
- DNA encoding the spike gene of SARS-CoV-2 isolate Wuhan-Hu-1 strain (GenBank: 286 MN908947.3) was chemically synthesized and used for cloning.
- 291 292 15 Affinity selection of SARS-CoV-2 GFPDL phages 293 Prior to panning of GFPDL with polyclonal hCoV-2IG antibodies, Ig components, which 294 could non-specifically interact with phage proteins, were removed by incubation with UV-killed 295 M13K07 phage-coated Petri dishes.
- Equal volumes of each of the six hCoV-2IG lots were used 296 for GFPDL panning.
- GFPDL affinity selection was carried out in-solution with protein A/G resin 297 as previously described(10-12).
- Similar numbers of bound 305 phage clones and epitope repertoire were observed in the two GFPDL panning.
Surface Plasmon Resonance (SPR) 309
- Steady-state equilibrium binding of hCoV-2IG lots was monitored at 25°C using a ProteOn 310 surface plasmon resonance .
- The purified recombinant SARS-CoV-2 RBD proteins were 311 captured to a Ni-NTA sensor chip with 200 resonance units (RU) in the test flow channels.
- Responses from the protein surface were 319 corrected for the response from a mock surface and for responses from a buffer-only injection.
- 320 SPR was performed with serially diluted samples in this study.
- Total antibody binding was 321 calculated with BioRad ProteOn manager software (version 3.1).
Statistical Analysis. 327
- All experimental data were analyzed in GraphPad Prism, version 9.0.1 (GraphPad software Inc, 328 San Diego, CA) or R package.
- The difference within each group were performed using one-way ANOVA using Tukey’s pairwise 331 multiple comparison test.
- 341 We thank Keith Peden and Marina Zaitseva for their insightful review of the manuscript.the authors.
- The funders had no role in study design, data 347 collection and analysis, decision to publish, or preparation of the manuscript.
- 348 The content of this publication does not necessarily reflect the views or policies of the Department 349 of Health and Human Services, nor does mention of trade names, commercial products, or 350 organizations imply endorsement by the U.S. Government.
Data and Materials availability 361
- All data needed to evaluate the conclusions in the current study are present in the main figures 362 and/or the Supplementary Materials.
- The materials generated during the current study are available 363 from corresponding author under a material transfer agreement on reasonable request.
FIGURE LEGENDS: 366
- 19 of phage clones and epitope repertoire was observed in both phage display analysis.
- Neutralizing antibody titers and RBD binding antibodies of convalescent plasma 394 and hCoV-2IG against various SARS-CoV-2 strains, also known as 392 393 Figure 2.
- The numbers above the group 416 show the mean antibody binding for each RBD.
- 100 100 98.2 100 100 974-1062 SSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVF.
Did you find this useful? Give us your feedback
Citations
34 citations
29 citations
10 citations
10 citations
2 citations
References
1,641 citations
530 citations
419 citations
396 citations
374 citations
Related Papers (5)
Frequently Asked Questions (9)
Q2. What was the statistical test used to analyze the differences between groups?
Differences between groups were analyzed using multiple group 329 comparisons by non-parametric (Kruskal-Wallis) statistical test using Dunn's post-hoc analysis.
Q3. How many dilutions of hCoV-2IG were used for the as?
315 Serial dilutions (1 mg/mL, 0.33 mg/mL and 0.11 mg/mL) of freshly prepared hCoV-2IG 316 or 2019-IVIG or 10-fold dilution of CP in BSA-PBST buffer (PBS pH 7.4 buffer with Tween-20 317 and BSA) were injected at a flow rate of 50 µL/min (120 sec contact duration) for association, and 318 disassociation was performed over a 600-second interval.
Q4. What is the titer of the antibody used in the hCoV-4?
(D) Antibody concentration (in mg/mL) required for each of the six hCoV-409 2IG batches to achieve 50% neutralization of SARS-CoV-2 WA-1, CA, UK, JP or SA variants in 410 PsVNA.
Q5. What is the significance of the titers for the variants?
The statistical 422 significances between the variants for hCoV-2IG were performed using One-way ANOVA using 423 21 Tukey’s pairwise multiple comparison test in GraphPad prism.
Q6. What is the mean fold-change in the titers for the three mutants?
(H) Fold-decrease in antibody binding to mutants 417 RBD-K417N, RBD-N501Y and RBD-E484K of hCoV-2IG in comparison with RBD-wt from 418 WA-1 strain calculated from the data in Panel G.
Q7. What is the titer of the hCoV-2IG?
(G-H) Total antibody binding (Max RU) of 1mg/mL for the six 414 batches of hCoV-2IG (hCoV-2IG-1 to hCoV-2IG-6) to purified WA-1 RBD (RBD-wt) and RBD 415 mutants: RBD-K417N, RBD-N501Y and RBD-E484K by SPR (G).
Q8. Who provided plasmid clones expressing SARS-CoV-2 variants?
The authors thank 342 Carol Weiss for providing plasmid clones expressing SARS-CoV-2 variants and Dorothy Scott for 343 providing convalescent plasma and hCoV-2IG.
Q9. What was the significance of the differences between the two groups?
The differences were considered statistically significant with a 95% confidence 391 interval when the p value was less than 0.05.