Showing papers on "Bifidobacterium bifidum published in 1999"
TL;DR: SM and LBD agar (aerobic) were useful to enumerate yoghurt bacteria and inhibit bifidobacteria and this set of media was demonstrated to be effective for the enumeration of S. thermophilus , Lactobacillus delbrueckii subsp.
236 citations
TL;DR: Production of b ifidocin B, but not immunity to bifidocIn B, was associated with a plasmid of about 8 kb in this strain, and the amino acid sequence indicated that the bacteriocin contained 36 residues.
Abstract: Z. YILDIRIM, D.K. WINTERS AND M.G. JOHNSON. 1999.Bifidocin B produced by Bifidobacterium bifidum NCFB 1454 was purified to homogeneity by a rapid and simple three step purification procedure which included freeze drying, Micro-Cel adsorption/desorption and cation exchange chromatography. The purification resulted in 18% recovery and an approximately 1900-fold increase in the specific activity and purity of bifidocin B. Treatment with bifidocin B caused sensitive cells to lose high amounts of intracellular K + ions and u.v.absorbing materials, and to become more permeable to ONPG. Bifidocin B adsorbed to the Gram-positive bacteria but not the Gram-negative bacteria tested. Its adsorption was pHdependent but not time-dependent. For sensitive cells, the adsorption and lethal action of bifidocin B was very rapid. In 5 min, 95% of bifidocin B adsorbed onto sensitive cells. Several salts inhibited the binding of bifidocin B, which could be overcome by increasing the amount of bifidocin B added. Pre-treatment of sensitive cells and cell walls with detergents, organic solvents or enzymes did not cause a reduction in subsequent cellular binding of bifidocin B, but cell wall preparations treated with methanol:chloroform and hot 20% (w/v) TCA lost the ability to adsorb bifidocin B. Also, the addition of purified heterologous lipoteichoic acid to sensitive cells completely blocked the adsorption of bifidocin B. The amino acid sequence indicated that the bacteriocin contained 36 residues. N-terminal amino acid sequence analysis yielded a sequence of KYYGNGVTCGLHDCRVDRGKATCGIINNGGMWGDIG. Curing experiments with 20 m gm l 1 acriflavine yielded cell derivatives that no longer produced bifidocin B but retained immunity to bifidocin B. Production of bifidocin B, but not immunity to bifidocin B, was associated with a plasmid of about 8 kb in this strain.
142 citations
TL;DR: Administration of yogurt supplemented with L. acidophilus and Bifidobacterium spp.
133 citations
TL;DR: The ability of Lf to promote the growth of Bifidobacterium spp.
Abstract: Lactoferrin (Lf) is an iron-binding protein which has been shown to inhibit the growth of various bacterial pathogens and promote the growth of anaerobic bacteria of the genus Bifidobacterium in vitro. The present study was designed to investigate whether the bifidobacteria growth promotion activity of Lf is correlated with either the binding of Lf to bifidobacterial cells or the iron saturation of Lf. Bovine Lf (bLf) from mature milk increased the growth of B. infantis and B. breve in vitro in a dose-dependent fashion, while much less growth promotion activity was found for B. bifidum. In contrast, human Lf (huLf) from mature milk promoted the growth of B. bifidum and was inactive for B. infantis and B. breve, while bLf from colostrum was devoid of bifidobacteria growth promotion activity. Changes in the iron content of Lf did not alter the bifidobacteria growth promotion activity of either bLf or huLf preparations. Competitive binding studies with biotinylated milk bLf showed that binding of bLf was inhibited by unlabelled bLf and huLf but not by β-lactoglobulin, α-lactalbumin or transferrin. Binding of bLf to B. bifidum and B. breve was c. 4C-fold higher than binding to Escherichia coli. Colostrum bLf was also found to bind to B. bifidum and B. breve, despite a lack of in-vitro growth promotion activity. Collectively, these results demonstrate that the ability of Lf to promote the growth of Bifidobacterium spp. in vitro is independent of the iron saturation level for Lf and suggest that binding of Lf to bifidobacteria cells may be involved but is not sufficient for stimulation of bifidobacterial growth.
91 citations
TL;DR: A new enzyme has been characterized in a cell‐free extract of Bifidobacterium bifidum that catalysed the reversible phosphorolytic cleavage of β‐1,3‐galacto‐oligosaccharides and is of particular interest in degrading some β‐D‐Gal( 1,3) linkages.
Abstract: A new enzyme has been characterized in a cell-free extract of Bifidobacterium bifidum that catalysed the reversible phosphorolytic cleavage of beta-1,3-galacto-oligosaccharides. In the presence of Pi, the phosphorolysis reaction was favoured and was accompanied by a Walden reaction. Cleavage of the beta-glycosidic linkage gave an alpha-galactoside derivative (alpha-D-galactose 1-phosphate). The enzyme possesses a high specificity for beta-D-galactosido-(1, 3)-N-acetylglucosamine and beta-D-galactosido-(1, 3)-N-acetylgalactosamine. This purified intracellular enzyme had an estimated molecular mass of 140 kDa. The galactophosphorolytic activity on disaccharides was optimal at pH 6-6.5 and the reverse reaction was optimal at pH 5.5-6. The temperature optimum for phosphorolysis and the reverse reaction was approx. 50-55 degrees C. This enzyme is of particular interest in degrading some beta-D-Gal(1, 3) linkages and should be classified as EC 2.4.1.-.
80 citations
TL;DR: It was concluded that the protection against Salm.
Abstract: The ability of Bifidobacterium bifidum from a commercial bifidus milk to antagonize Salmonella enteritidis subsp. typhimurium in vivo, and to reduce the pathological consequences for the host, was determined using conventional and gnotobiotic mice. Conventional animals received daily, by gavage, 0.1 ml bifidus milk containing about 10(9) cfu B. bifidum and germ-free animals received a single 0.1 ml dose. The conventional and gnotobiotic groups were challenged orally with 10(2) cfu of the pathogenic bacteria 5 and/or 10 d after the beginning of treatment. Control groups were treated with milk. Bifidus milk protected both animal models against the challenge with the pathogenic bacteria, as demonstrated by survival and histopathological data. However, to obtain the protective effect in gnotobiotic animals, the treatment had to be initiated 10 d before the challenge. In experimental and control gnotobiotic mice, Salm. enteritidis subsp. typhimurium became similarly established at levels ranging from 10(8) to 10(9) viable cells g-1 of faeces and remained at these high levels until the animals died or were sacrificed. It was concluded that the protection against Salm. enteritidis subsp. typhimurium observed in conventional and gnotobiotic mice treated with bifidus milk was not due to the reduction of the intestinal populations of the pathogenic bacteria.
80 citations
Patent•
14 May 1999
TL;DR: In this article, a microbe composition comprising three viable and beneficial lactic acid producing bacteria of new strains: Bifidobacterium bifidum 6-1, Lactobacillus acidophilus YIT 2004 (CCTCC Number M 98004) and Streptococcus faecalis YIT 0027, was presented.
Abstract: This invention provides a microbe composition comprising three viable and beneficial lactic acid producing bacteria of new strains: Bifidobacterium bifidum 6-1 (CCTCC Number M 98003), Lactobacillus acidophilus YIT 2004 (CCTCC Number M 98004) and Streptococcus faecalis YIT 0027 (CCTCC Number M 98005). This invention also provides the materials to protect the viability of the lactic acid producing bacteria in lyophilized form and the method to prepare the composition. Finally, this invention provides various uses of the composition.
57 citations
TL;DR: Results indicated that ingestion of AB yogurt increased the counts of anaerobic bacteria, suppressed aerobic bacteria, and significantly elevated the bifidus to coliform ratio, which gradually diminished and disappeared after yogurt consumption was discontinued.
50 citations
TL;DR: The data suggest that although adhesion to epithelial surfaces is considered an important prerequisite for probiotic activity, high adhesiveness may not guarantee protective properties in a selected strain.
47 citations
TL;DR: Among various isoquinoline alkaloids, BC exhibited more potent inhibitory activity toward C. perfringens than BI and BS, whereas the inhibitory effect was more pronounced in PI compared to PC and PS.
Abstract: The growth-inhibiting activity of Coptis japonica (Makino) root-derived materials toward eight human intestinal bacteria was examined using an impregnated paper disk method and compared to that of four commercially available isoquinoline alkaloids [berberine sulfate (BS), berberine iodide (BI), palmatine chloride (PC), and palmatine sulfate(PS)], as well as that of Thea sinensis leaf-derived epigallocatechin gallate (EGCG). The biologically active constituents of the Coptis extract were characterized as the isoquinoline alkaloids berberine chloride (BC), palmatine iodide (PI), and coptisine chloride (CC) by spectral analysis. The growth responses varied with both chemical and bacterial strain used. In a test using 500 microg/disk, BC and PI produced a clear inhibitory effect against Bifidobacterium longum, Bifidobacterium bifidum, Clostridium perfringens, and Clostridium paraputrificum, whereas weak or no inhibition was observed in Bifidobacterium adolescentis, Lactobacillus acidophilus, Lactobacillus casei, and Escherichia coli. At 1000 microg/ disk, CC revealed weak or no growth inhibition toward all test bacteria, whereas EGCG exhibited weak growth inhibition against only C. perfringens and C. paraputrificum. Among various isoquinoline alkaloids, BC exhibited more potent inhibitory activity toward C. perfringens than BI and BS, whereas the inhibitory effect was more pronounced in PI compared to PC and PS. The Coptis root-derived materials did not promote growth of B. longum and C. perfringens.
36 citations
TL;DR: Microentrapment of bifidobacteria improved their survival during storage of stirred yoghurt, especially Bif.Bifidum, whose viability was not significantly (P≯0.05) different from entrappedBif.
Abstract: Fifteen batches of stirred youghurt were made to study the effect of microentrapment on the viability of bifidobacteria and their ability to inhibit the growth ofE. coliandStaph. aureus. Entrapped cells ofBifidobacterium bifidumandBifidobacterium infantiswere able to produce antimicrobial agents which inhibitedE. coliandStaph. aureusused as test organisms. Viable counts of unentrapped bifidobacteria decreased sharply, while entrapped cells of bifidobacteria were quite stable during refrigerated storage of stirred yoghurt.Bif. infantiswas more tolerant to storage conditions thanBif. bifidum. Microentrapment of bifidobacteria improved their survival during storage of stirred yoghurt, especiallyBif. bifidum, whose viability was not significantly (P≯0.05) different from entrappedBif. infantis. Viable counts ofE. colidecreased during storage of stirred yoghurt. Addition to bifidobacteria caused a sharp decrease in the viability ofE. coli.E.coligrowth was not detected at the 5th day, when entrapped cells of bif...
TL;DR: It is indicated that B. bifidum can act as a lipopolysaccharide-like polyclonal activator for B cells and enable B cells to respond to transforming growth factor-beta 1 and interleukin-5 for the IgA production has important implications for the primary defense against pathogens in the gastrointestinal tract.
Journal Article•
TL;DR: The data presented in this work are indicative of the possibility and advantages of using bifidobacterial strains belonging to this ecological niche as probiotics for the correction of the microflora of the urogenital tract in females.
Abstract: The composition of vaginal bifidoflora in 56 clinically healthy women of reproductive age was studied. The study revealed that four species of bifidobacteria, viz. Bifidobacterium bifidum, B. breve, B. adolescentis 2 and B. longum, dominated in the composition of this bifidobacterial population. Nine out of 11 isolated strains were found to be capable of inhibiting indicator microorganisms Staphylococcus aureus and Enterococcus faecalis when tested in vitro; in addition, strains B. adolescentis 2 F1, B. bifidum G1, B. breve P2 and B. longum Z4 inhibited Klebsiella ozaenae, Pseudomonas aeruginosa, Escherichia coli and were also active acid producers. Three of these 4 bifidobacterial strains were capable of adhesion to vaginal epitheliocytes, while B. bifidum G1 was practically incapable of adherence to these cells, similarly to B. bifidum strain 791 of intestinal origin. In addition, the spectra of antibiotic susceptibility varied from strain to strain, but all bifidobacterial strains were susceptible to benzylpenicillin and resistant to lomefloxacin, most of them being also resistant to cyprofloxacin and gentamicin. Thus the data presented in this work are indicative of the possibility and advantages of using bifidobacterial strains belonging to this ecological niche as probiotics for the correction of the microflora of the urogenital tract in females.
TL;DR: Some of the isolated fractions were found to enhance the growth of Bifidobacterium bifidus var.
Patent•
18 Jan 1999
TL;DR: In this paper, a mixture of lyophilized live bacteria was used to make beverages for food use in the United States, and the combination with a mixture consisting of at least three live bacteria species selected from Bifidobacterium breve and infantis was used.
Abstract: The invention relates to beverages for food use in
combination with a mixture of lyophilized live bacteria
comprising at least three bacteria species selected from
Bifidobacterium breve, Bifidobacterium infantis,
Bifidobacterium longum, Bifidobacterium bifidum,
Lactobacillus acidophilus, Streptococcus thermophilus,
Lactobacillus bulgaricus, Lactobacillus casei,
Lactobacillus plantarum, Streptococcus faecium.
TL;DR: Two rRNA gene clusters were detected in the genome of Bifidobacterium bifidum KCTC 3202T using Southern blot analysis and sequence differences were not found between rrnA and rrnB in 1488 bp of the 16S rRNA genes.
Abstract: Two rRNA gene clusters were detected in the genome of Bifidobacterium bifidum KCTC 3202T using Southern blot analysis To analyse the sequences of the 16S rRNA genes from rrnA and rrnB, 16S rDNAs were amplified by PCR using DNA fragments purified from gel slices containing each of the rRNA gene clusters The amplified 16S rDNAs from rrnA and rrnB were cloned into vectors and three clones of each gene sequenced The resultant sequences were confirmed by direct sequencing of the 16S rDNAs from rrnA and rrnB Sequence differences were not found between rrnA and rrnB in 1488 bp of the 16S rRNA genes
TL;DR: It was proved that several peptidic ingredients in the adsorbed fraction increased the growth of B. bifidum.
Abstract: Natural rubber serum powder, rich in crude protein and carbohydrates, had a strong growth-stimulating activity for Bifidobacterium bifidum JCM 1254, which was unable to grow in a fully synthetic medium, B12 assay medium. Natural rubber serum powder was fractionated by ultrafiltration (molecular weight cutoff 1000). The active ultrafiltrate was further concentrated and desalted with an adsorptive microconcentrator, which adsorbs virtually all amino acids and peptides. Through this purification step, it was found that the adsorbed fraction obtained did not stimulate growth independently but acted complementarily with a small amount of ammonium sulfate. The adsorbed fraction was subsequently analyzed on reversed-phase high pressure liquid chromatography, and the activities of the eluates were measured on B12 assay medium with ammonium sulfate. Consequently, it was proved that several peptidic ingredients in the adsorbed fraction increased the growth of B. bifidum.
TL;DR: Whole peptidoglycan of Bifidobacterium bifidum could induce cell apoptosis of nude mice transplantation tumors of colorectal carcinoma by down-regulating the expression of the bcl-2 gene and upregulate the expressionof the bax gene.
Abstract: Objective: To explore the antitumor mechanisms of whole peptidoglycan of bifidobacterium. Methods: The apoptotic cells and the positive expression of bcl-2 and bax oncoprotein were studied nude mice transplantation tumors of colorectal carcinoma by employing in situ end labeling technique and immunohistochemical staining. Results: The apoptotic cell density, the positive rate and the staining intensity of bax oncoprotein of the transplantation tumor of colorectal carcinoma in the whole peptidoglycan injection group were significantly higher when compared with the tumor control group. The positive rate of bcl-2 oncoportein in the whole peptidoglycan injection group was obviously lower than that in the tumor control group (P<0.01). Conclusion: Whole peptidoglycan of Bifidobacterium bifidum could induce cell apoptosis of nude mice transplantation tumors of colorectal carcinoma by down-regulating the expression of the bcl-2 gene and upregulating the expression of the bax gene.
TL;DR: No evidence was found to support the notion that Lactobacillus combined with B. bifidum decreases the incidence of antibiotic-associated diarrhoea, and patients taking fructo-oligosacchrides without the addition of bacteria were observed to be less likely to develop diarrhoeA when taking antibiotics.
Patent•
20 May 1999
TL;DR: In this paper, milk is pasteurized or sterilized and cooled to fermentation temperature and fermenting agent "Acidolact" is added to the milk to reduce the fermentation time of process.
Abstract: FIELD: medicine, dairy and microbiological industry. SUBSTANCE: milk is pasteurized or sterilized and cooled to fermentation temperature and fermenting agent "Acidolact" is added. Fermenting agent has viscous thermophilic strains Lactobacillus acidophilus of "AB" type at titer value 1 x 10 CFU/ml, not less, and a concentrate of bifidobacteria containing strain Bifidobacterium bifidum and/or strain Bifidobacterium longum at titer value 0.8 x 10 CFU/ml, not less. Fermenting agent of viscous strain of thermophilic streptococci Streptococcus thermophilus at amount 2.0-3.0% of the obtained mass mixture is added to milk with a fermenting agent of bifido- and acidophilic bacteria. Method ensures to obtain dietetic and curative-prophylactic fermented-milk product for every day use for long period. EFFECT: decreased fermentation time of process, simplified technology of preparing. 8 cl, 8 tbl, 7 ex
Patent•
10 Dec 1999
TL;DR: In this article, the authors presented a simplified production method by using optimum kinds of bifidobacteria in preparation 4 cl, 1 dwg, 2 tbl, 6 ex.
Abstract: FIELD: biotechnology, in particular, production of eubiotic preparations SUBSTANCE: method involves preparing ferment by cultivating bifidobacteria of Bifidibacterium bifidum, Bifidobacterium longum, Bifidobactrium infantis or Bifidobacterium adolescentis kinds in nutritive medium; introducing protective medium into it with following liophylic drying or preparing cultured milk product in liquid state by introducing sown dose of obtained ferment into pasteurized milk in an amount not exceeding 5% of volume of nutritive medium; providing repeated cultivation of mentioned kinds of bifidobacteria at temperature of 38 C plus and minus 1 C till bunching; cooling and packing product To produce ferment or cultured milk product in liquid state, each kind of bifidobacteria is separately cultivated till obtaining of biomasses titrated to at least 10 CFU/ml and joined together prior to drying of ferment or prior to packing of biomass of cultivated milk product of bifidobacteria to obtain product in the form of mixture of mentioned kinds of bifidobacteria To produce preparation for babies of up to 3-5 years, bifidobacteria of Bifidobacterium bifidum, Bifidobacterium longum, Bifidobacterium breve or Bifidobacterium infantis kinds are used, and for teenagers or grownups - bifidobacteria of Bifidobacretium bifidum, Bifidobacterium longum and Bifidobacterium adolescentis kinds are used Ratio of biomass of separate kinds of bifidobacteria in preparation is set in accordance with ratio of these bifidobacteria in intestines of healthy individual of definite age, obtained on the base of statistic data and regression analysis EFFECT: improved medicinal and prophylactic properties of bifidopreparations, wider range of usage, improved compatibility with individual intestines normoflora and simplified production method by using optimum kinds of bifidobacteria in preparation 4 cl, 1 dwg, 2 tbl, 6 ex
Journal Article•
Patent•
09 Feb 1999
TL;DR: In this paper, the problem of obtaining a monoclonal antibody specifically recognizing Bifidobacterium bifidum YIT 4007 strain (FERM P-5871) was addressed.
Abstract: PROBLEM TO BE SOLVED: To obtain a monoclonal antibody for a Bifidobacterium bifidum, capable of detecting bacteria simply, rapidly and inexpensively, useful for foods, medicines, etc., by specifically recognizing Bifidobacterium bifidum YIT 4007 strain. SOLUTION: This monoclonal antibody specifically recognizes Bifidobacterium bifidum YIT 4007 strain (FERM P-5871). Preferably colloidal gold particles are adsorbed on the monoclonal antibody to prepare a monoclonal antibody sensitization colloidal gold, an antigen group to be examined is reacted with the monoclonal antibody sensitization colloidal gold, washed and a red antigen to be examined to which the monoclonal antibody sensitization gold is stuck is detected by visual observation to detect an antigen. Preferably a fused cell (hybridoma) (FERM P-16259) for producing the monoclonal antibody is prepared.
Patent•
10 Feb 1999
TL;DR: In this article, a method for the collection of feces samples from a single organism from its clinically health state beginning from 7-15 postnatal life and during spanlife by analysis once per a year is presented.
Abstract: FIELD: medicine, microbiology. SUBSTANCE: method involves selection of feces samples from a single organism from its clinically health state beginning from 7-15 postnatal life and during spanlife by analysis once per a year. Autostrains of normal intestine microflora are isolated from samples and identified. Biomass of each bacterium species is produced separately on selective nutrient media to titer 10 3 -10 cells/ml, not less. Obtained biomasses are combined, stabilizing composition is added and a mixture is divided for samples. Each sample is preserved and stored for human spanlife under periodical biotiter monitoring. At infant age (less 1 year) normal intestine microflora has the following bifidobacteria of species: Bifidobacterium bifidum, Bifidobacterium brevis, Bifidobacterium infantis and lactobacteria of species Lactobacillus acidophilus, Lactobacillus fermenti. At age above 1 year normal species of intestine microflora are mainly Bifidobacterium longum, Bifidobacterium adolescents, lactobacteria of species Lactobacillus acidophilus, Lactobacillus fermenti, Lactobacillus plantarum, strains of bacteria Escherichia coli and lactic acid streptococci of species mainly Streptococcus faecium, Streptococcum faecalis, Streptococcus avium, Streptococcus salivarius and Streptococcus bovis. During storage after biotiter control samples of bacterium autostrains isolated from normal human intestine microflora taken off at different spanlife are combined at an equal ratios. Administration of microorganism autostrains bank samples in human intestine ensures to effect on different links of damaged intestine bacteriocenosis simultaneously by means of using the more complete spectrum of normal intestine microflora. Invention can be used for prophylaxis and treatment of patients with intestine disbacteriosis in human. EFFECT: improved method of bank preparing, enhanced effectiveness of treatment. 7 cl, 6 ex
Patent•
10 Oct 1999
TL;DR: A supercream providing increase in cosmetic effect on skin due to blocking three mechanisms of skin ageing (accumulation of crosslinked inflexible collagen, formation of cross-links in hyaluronic acid molecules, and deceleration of epidermis basal layer cell proliferation) contains, wt %: enzyme collase 0.0001-0.001, inactivated cock sperm and/or echinus gonads and cellular detrite of bacteria Bifidobacterium bifidum and enzyme hyaluronidase, 10.0-30.
Abstract: FIELD: cosmetics. SUBSTANCE: supercream providing increase in cosmetic effect on skin due to blocking three mechanisms of skin ageing (accumulation of cross-linked inflexible collagen, formation of cross-links in hyaluronic acid molecules, and deceleration of epidermis basal layer cell proliferation) contains, wt %: enzyme collase 0.0001-0.001, inactivated cock sperm and/or echinus gonads and/or cellular detrite of bacteria Bifidobacterium bifidum and/or enzyme hyaluronidase 0.0001-7.5, natural- and chemical-origin biologically-active substances 10.0-30.0, water-soluble gel basis - the balance. EFFECT: improved cosmetic quality. 8 cl, 9 ex
Patent•
25 Feb 1999
TL;DR: Consortium of strains bifidobacterium Bifidum CMPM VNIIgenetica B-3300, Bifidisprobstium breve GKNM Gabrichevsky Institute of Epidemiology and Microbiology N153, bifidsophilus infantis in GKN M Gabrichesky IMI N155 and Bifidesophilus adolescentis GKN m gkGkG N158 for producing sourly-milk products of dietetic nutrition, nonenzymatic food products and bacteria preparations as mentioned in this paper.
Abstract: Consortium of strains bifidobacterium Bifidobacterium bifidum CMPM VNIIgenetica B-3300, Bifidobacterium CMPM VNIIgenetica B-2000, Bifidobacterium breve GKNM Gabrichevsky Institute of Epidemiology and Microbiology N153, Bifidobacterium infantis in GKNM Gabrichevsky Institute of Epidemiology and Microbiology N155, Bifidobacterium adolescentis GKNM Gabrichevsky Institute of Epidemiology and Microbiology N158 for producing sourly-milk products of dietetic nutrition, non-enzymatic food products and bacteria preparations.