Journal ArticleDOI
The sodium influx stimulating peptide of the pulmonate freshwater snail Lymnaea stagnalis.
Reads0
Chats0
TLDR
In Lymnaea stagnalis, integumental Na + uptake is stimulated by the sodium influx stimulating (SIS)-peptide as mentioned in this paper, and the primary structure was determined as: SRTQSRFASYELMGTEGTECVTTKTISQICYQCATRHEDSFVQVYQECCKKEMGLREYCEEIYTELPIRSGLWQPN.About:
This article is published in Peptides.The article was published on 1993-07-01. It has received 11 citations till now. The article focuses on the topics: Lymnaea stagnalis.read more
Citations
More filters
Journal ArticleDOI
Early evolutionary origin of the neurotrophin receptor family.
Ronald E. van Kesteren,Mike Fainzilber,Mike Fainzilber,Garry Hauser,Jan van Minnen,Erno Vreugdenhil,August B. Smit,Carlos F. Ibáñez,Wijnand P. M. Geraerts,Andrew G. M. Bulloch +9 more
TL;DR: A molluscan Trk receptor from the snail Lymnaea stagnalis is described, supporting an early evolutionary origin of the Trk family as neuronal receptor tyrosine kinases and suggesting that Trk signalling mechanisms may be highly conserved between vertebrates and invertebrates.
Journal ArticleDOI
Direct peptide profiling of single neurons by matrix‐assisted laser desorption–ionization mass spectrometry
P. A. van Veelen,Connie R. Jimenez,Ka Wan Li,Willem C. Wildering,Wijnand P. M. Geraerts,U.R. Tjaden,J. van der Greef +6 more
TL;DR: In this article, matrix-assisted laser desorption-ionization mass spectrometry was used to characterize peptide profiles of single neurons in Lymnaea stagnalis.
Journal ArticleDOI
Pattern changes of pituitary peptides in rat after salt-loading as detected by means of direct, semiquantitative mass spectrometric profiling
Connie R. Jimenez,Ka Wan Li,K. Dreisewerd,Huibert D. Mansvelder,Arjen B. Brussaard,Bruce B. Reinhold,R. C. Van Der Schors,Michael Karas,F. Hillenkamp,J. P. H. Burbach,Catherine E. Costello,Wijnand P. M. Geraerts +11 more
TL;DR: A differential peptide display method is established to detect peptides that show semiquantitative changes in the neurointermediate lobe (NIL) of individual rats subjected to salt-loading, and a selective and significant decrease in the intensities of several molecular ion species of the NIL homogenates from salt-loaded rats is revealed.
Journal ArticleDOI
Expression and distribution of transcription factor CCAAT/enhancer-binding protein in the central nervous system of Lymnaea stagnalis
TL;DR: The results suggest that LymC/EBP is involved in learning and memory and in the expression and/or secretion of neuropeptides in Lymnaea.
Journal ArticleDOI
The neuroendocrine system of annelids
TL;DR: It is demonstrated in this review that annelids, which are considered "simple" animals, also possess a neuroendocrine system, allowing bidirectional communication between neural and endocrine structures over distances greater than that achieved by synaptic communication.
References
More filters
Journal ArticleDOI
Improved tools for biological sequence comparison.
TL;DR: Three computer programs for comparisons of protein and DNA sequences can be used to search sequence data bases, evaluate similarity scores, and identify periodic structures based on local sequence similarity.
Journal ArticleDOI
Ultrastructure and histochemistry of neurosecretory cells and neurohaemal areas in the pond snail Lymnaea stagnalis (L.)
TL;DR: Seven types have been distinguished within the class of Gomori-positive cells on the basis of different staining reactions with the alcian blue/alcian yellow technique, which revealed that each of the histochemically distinguished secretory substances consists of elementary granules which differ in size and appearance from each other and from the neurosecretory elementarygranules which have been described in the cerebral ganglia and in the lateral lobes.
Journal Article
Sodium regulation in the freshwater mollusc Limnaea stagnalis (L.) (Gastropoda: Pulmonata).
TL;DR: Limnaea stagnalis has a sodium uptake mechanism with a high affinity for sodium ions, near maximum influx occurring in external sodium concentrations of 1.5-2 mM-Na/l and half maximum influx at 0.25 mM/l, and an experimentally induced reduction of blood volume increases sodium uptake to three times the normal level.
Journal ArticleDOI
A Method for Breeding and Studying Freshwater Snails Under Continuous Water Change, With Some Remarks On Growth and Reproduction in Lymnaea Stagnalis (L.)
TL;DR: An experimental equipment permitting the study of freshwater snails under regulated conditions, continuous water change included, is described and Lymnaea stagnalis can be bred in large densities under these conditions, without growth and reproduction being interfered with.
Journal ArticleDOI
Isolation, characterization, and evolutionary aspects of a cDNA clone encoding multiple neuropeptides involved in the stereotyped egg-laying behavior of the freshwater snail Lymnaea stagnalis.
Erno Vreugdenhil,JF Jackson,T Bouwmeester,August B. Smit,J. Van Minnen,H van Heerikhuizen,Jacobus Klootwijk,J. Joosse +7 more
TL;DR: RNA blot analysis and in situ hybridization experiments demonstrated that the CDCs are the major cell groups in the cerebral ganglia that transcribe the CDCH gene, which indicates a vital function of these peptides in Aplysia, as well as in Lymnaea species.