Journal ArticleDOI
A comparison of different strategies for antimicrobial peptides incorporation onto/into lipid nanocapsules.
Nada Matougui,Anne-Claire Groo,Anita-Monika Umerska,Anita-Monika Umerska,Viviane Cassisa,Patrick Saulnier +5 more
TLDR
A lipid nanocapsule-based platform appears suitable to deliver AMPs, and the covalent attachment strategy turned out to be less conclusive due to peptide inactivation.About:
This article is published in Nanomedicine: Nanotechnology, Biology and Medicine.The article was published on 2019-07-01. It has received 17 citations till now. The article focuses on the topics: Antimicrobial peptides & Peptide.read more
Citations
More filters
Handbook Of Proteolytic Enzymes
TL;DR: The handbook of proteolytic enzymes is universally compatible with any devices to read and is available in the book collection an online access to it is set as public so you can get it instantly.
Journal ArticleDOI
Antimicrobial peptides as therapeutic agents: opportunities and challenges
TL;DR: The efforts to translate AMP-based research findings into pharmaceutical product candidates are expected to accelerate in coming years due to technological advancements in multiple areas, including an improved understanding of the mechanism-of-action of AMPs, smart formulation strategies, and advanced chemical synthesis protocols.
Journal ArticleDOI
The structure-mechanism relationship and mode of actions of antimicrobial peptides: A review
TL;DR: The structure characteristics related with bactericide actions, including peptides constituents, molecular length, molecular charges and so on are reviewed, and the common mode of actions of AMPs raised by researchers are summarized.
Journal ArticleDOI
Nanomaterials with active targeting as advanced antimicrobials.
Kristyna Smerkova,Kristyna Smerkova,Kristyna Dolezelikova,Kristyna Dolezelikova,Lucie Bozdechova,Lucie Bozdechova,Zbynek Heger,Zbynek Heger,Ludek Zurek,Ludek Zurek,Vojtech Adam,Vojtech Adam +11 more
TL;DR: This review aims to discuss advantages, disadvantages, and challenges of nanomaterials in the context of the targeting strategies for antimicrobials as advanced tools for treatments of bacterial infections.
Journal ArticleDOI
Current Advances in Lipid and Polymeric Antimicrobial Peptide Delivery Systems and Coatings for the Prevention and Treatment of Bacterial Infections
TL;DR: In this paper, the authors evaluated the chemical characteristics and antibacterial effects of lipid and polymeric AMP delivery systems and coatings that offer the promise of enhancing the efficacy of AMPs, reducing their limitations and prolonging their half-life.
References
More filters
Journal ArticleDOI
Lipid nanocarriers as drug delivery system for ibuprofen in pain treatment
TL;DR: A drug delivery system for intravenous administration of ibuprofen has been developed which exhibits sustained release properties by either oral or intravenous route and may be interesting in the treatment of postoperative pain.
Journal ArticleDOI
Boosting antimicrobial peptides by hydrophobic oligopeptide end tags.
Artur Schmidtchen,Mukesh Pasupuleti,Matthias Mörgelin,Mina Davoudi,Jan Alenfall,Anna Chalupka,Martin Malmsten +6 more
TL;DR: The generality of end tagging for facile boosting of antimicrobial peptides without the need for post-synthesis modification was demonstrated, and tagging resulted in enhanced killing of Gram-positive Staphylococcus aureus, Gram-negative Escherichia coli, and fungal Candida albicans.
Journal ArticleDOI
Membrane interactions of mesoporous silica nanoparticles as carriers of antimicrobial peptides
Katharina Braun,Alexander Pochert,Mika Lindén,Mina Davoudi,Artur Schmidtchen,Randi Nordström,Martin Malmsten +6 more
TL;DR: Investigation of effects of nanoparticle charge and porosity on AMP loading and release, as well as consequences of this for membrane interactions and antimicrobial effects finds anionic mesoporous silica particles were found to incorporate considerable amounts of the cationic AMP [LL-37, 37 aa] (LL-37), whereas loading is much lower for non-porous or positively charged silica nanoparticles.
Journal ArticleDOI
Low dose gemcitabine-loaded lipid nanocapsules target monocytic myeloid-derived suppressor cells and potentiate cancer immunotherapy
Maria Stella Sasso,Giovanna Lollo,Marion Pitorre,Samantha Solito,Laura Pinton,Sara Valpione,Guillaume Bastiat,Susanna Mandruzzato,Vincenzo Bronte,Ilaria Marigo,Jean-Pierre Benoit +10 more
TL;DR: The results show that GemC12-LNCs have monocyte-targeting properties that can be useful for immunomodulatory purposes, and unveil new possibilities for the exploitation of nanoparticulate drug formulations in cancer immunotherapy.
Journal ArticleDOI
Novel formulations for antimicrobial peptides.
TL;DR: Novel formulations may improve the therapeutic index of antimicrobial peptides by protecting their activity and improving their bioavailability, according to the limits of nanotechnology.