Journal ArticleDOI
Antimicrobial peptides: pore formers or metabolic inhibitors in bacteria?
TLDR
In this review the different models of antimicrobial-peptide-induced pore formation and cell killing are presented and several observations suggest that translocated peptides can alter cytoplasmic membrane septum formation, inhibit cell-wall synthesis, inhibit nucleic-acid synthesis, inhibits protein synthesis or inhibit enzymatic activity.Abstract:
Antimicrobial peptides are an abundant and diverse group of molecules that are produced by many tissues and cell types in a variety of invertebrate, plant and animal species. Their amino acid composition, amphipathicity, cationic charge and size allow them to attach to and insert into membrane bilayers to form pores by 'barrel-stave', 'carpet' or 'toroidal-pore' mechanisms. Although these models are helpful for defining mechanisms of antimicrobial peptide activity, their relevance to how peptides damage and kill microorganisms still need to be clarified. Recently, there has been speculation that transmembrane pore formation is not the only mechanism of microbial killing. In fact several observations suggest that translocated peptides can alter cytoplasmic membrane septum formation, inhibit cell-wall synthesis, inhibit nucleic-acid synthesis, inhibit protein synthesis or inhibit enzymatic activity. In this review the different models of antimicrobial-peptide-induced pore formation and cell killing are presented.read more
Citations
More filters
Journal ArticleDOI
The Staphylococcus aureus two-component regulatory system, GraRS, senses and confers resistance to selected cationic antimicrobial peptides.
Soo-Jin Yang,Arnold S. Bayer,Arnold S. Bayer,Nagendra N. Mishra,Michael Meehl,Nagender Ledala,Michael R. Yeaman,Michael R. Yeaman,Yan Q. Xiong,Yan Q. Xiong,Ambrose L. Cheung +10 more
TL;DR: An important role of the graRS and vraFG loci in the sensing of and response to specific CAPs involved in innate host defenses is supported.
Journal ArticleDOI
Membrane interactions of mesoporous silica nanoparticles as carriers of antimicrobial peptides
Katharina Braun,Alexander Pochert,Mika Lindén,Mina Davoudi,Artur Schmidtchen,Randi Nordström,Martin Malmsten +6 more
TL;DR: Investigation of effects of nanoparticle charge and porosity on AMP loading and release, as well as consequences of this for membrane interactions and antimicrobial effects finds anionic mesoporous silica particles were found to incorporate considerable amounts of the cationic AMP [LL-37, 37 aa] (LL-37), whereas loading is much lower for non-porous or positively charged silica nanoparticles.
Journal ArticleDOI
Bacterial disease management: challenges, experience, innovation and future prospects: Challenges in Bacterial Molecular Plant Pathology.
TL;DR: How advances in bacterial genetics, genomics and host-pathogen interactions are informing novel strategies in virulence inhibition and in host resistance are described, as well as potential innovations that could be exploited as the pressures to maximize a safe and productive food supply continue to become more numerous and more complex.
Journal ArticleDOI
Covalent binding of the natural antimicrobial peptide indolicidin to DNA abasic sites
Christophe Marchand,Krzysztof Krajewski,Hsiu-Fang Lee,Smitha Antony,Allison A. Johnson,Ronak Amin,Peter P. Roller,Mamuka Kvaratskhelia,Yves Pommier +8 more
TL;DR: It is found that indolicidin interferes with formation of the catalytic integrase-DNA complex by directly binding DNA and that multiple actions at the level of DNA might be a common property of antimicrobial peptides.
Journal ArticleDOI
Antimicrobial activity of histidine-rich peptides is dependent on acidic conditions
Lukasz A. Kacprzyk,Victoria Rydengård,Matthias Mörgelin,Mina Davoudi,Mukesh Pasupuleti,Martin Malmsten,Artur Schmidtchen +6 more
TL;DR: It is demonstrated that the presence of an acidic environment is an important regulator of the activity of histidine-rich antimicrobial peptides and pH-dependent antimicrobial activities were demonstrated for peptides derived from histidine -rich and heparin-binding regions of human kininogen and histazine-rich glycoprotein.
References
More filters
Journal ArticleDOI
MOLSCRIPT: a program to produce both detailed and schematic plots of protein structures
TL;DR: The MOLSCRIPT program as discussed by the authors produces plots of protein structures using several different kinds of representations, including simple wire models, ball-and-stick models, CPK models and text labels.
Journal ArticleDOI
Bacterial biofilms : A common cause of persistent infections
TL;DR: Improvements in understanding of the genetic and molecular basis of bacterial community behavior point to therapeutic targets that may provide a means for the control of biofilm infections.
Journal ArticleDOI
Antimicrobial peptides of multicellular organisms
TL;DR: As the need for new antibiotics becomes more pressing, could the design of anti-infective drugs based on the design principles these molecules teach us?
Book ChapterDOI
Raster3D: photorealistic molecular graphics.
Ethan A. Merritt,David Bacon +1 more
TL;DR: Raster3D is discussed, which is a suite of programs for molecular graphics, which must compromise the quality of rendered images to achieve rendering speeds high enough for useful interactive manipulation of three-dimensional objects.
Journal ArticleDOI
Defensins: antimicrobial peptides of innate immunity.
TL;DR: This review, inspired by a spate of recent studies ofdefensins in human diseases and animal models, focuses on the biological function of defensins.